Halfpricelawyers.com receives about 1329 visitors in one month. That could possibly earn $6.65 each month or $0.22 each day. Server of the website is located in the United States. Halfpricelawyers.com main page was reached and loaded in 0.9 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Traffic and Value
| Is halfpricelawyers.com legit? | |
| Website Value | $120 |
| Alexa Rank | 2805191 |
| Monthly Visits | 1329 |
| Daily Visits | 45 |
| Monthly Earnings | $6.65 |
| Daily Earnings | $0.22 |
Halfpricelawyers.com Server Location
Country: United States
Metropolitan Area: Mountain View
Postal Reference Code: 94043
Latitude: 37.4043
Longitude: -122.0748
Summarized Content
Halfpricelawyers Main Page Content
| HTML Tag | Content | Informative? |
|---|---|---|
| Title: | Affordable Lawyers in Las Vegas | Half Price | Could be improved |
| Description: | We provide the best legal advice in Las Vegas, and it's affordable! Our caring attorneys and staff have over 100 years of combined experience to help |  |
| H1: | Business Law | Is it informative enough? |
| H2: | Call Toll Free | Is it informative enough? |
We've noticed that you have issues with some content elements on the main page:
• Title contains 52 characters. We think that you could improve this tag by adding more relevant information or keywords.
• Take a look at the headings; there might be too little information. Headings are important for usability and search engine optimization.
Other Helpful Websites and Services for Halfpricelawyers
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for halfpricelawyers.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto halfpricelawyers.com
Alexa - halfpricelawyers.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on halfpricelawyers.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to halfpricelawyers.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from halfpricelawyers.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 104.196.236.63 IP
View a list of websites with an IP matching that of halfpricelawyers.com from Bing.com
Internal Pages
| /home/feed/: | |
|---|---|
| Title |
Comments on: Affordable Lawyers in Las Vegas | Half Price Lawyers |
| Description |
Not defined |
| /mark-coburn/: | |
|---|---|
| Title |
Mark Coburn - Las Vegas Attorney at Half Price Lawyers |
| Description |
Meet Mark Coburn, Attorney at Half Price Lawyers. Mr. Coburn has successfully represented criminal cases in Nevada with a high level of skill, experience, and an understanding of Nevada’s complex Criminal Defense laws. |
| H1 |
Mark Coburn, Esq. |
| H2 |
Call Toll Free |
| H3 |
Education |
| /schedule-a-free-consultation/: | |
|---|---|
| Title |
Schedule A Free Consultation with Half Price Lawyers in Las Vegas |
| Description |
Schedule a free consultation today and talk to one of our best and very experienced lawyer. For more details call us on (702) 400-0000 |
| H1 |
Schedule A Free Consultation |
| H2 |
Call Toll Free |
| /virtual-consultations/: | |
|---|---|
| Title |
Free Virtual Consultations Now Available - Half Price Lawyers |
| Description |
Not defined |
| H1 |
Free Virtual Consultations Now Available |
| H2 |
Call Toll Free |
| H3 |
Do you only offer Virtual Consultations during regular business hours? |
| /criminal-defense/: | |
|---|---|
| Title |
Las Vegas Criminal Defense Attorneys | Half Price Lawyers |
| Description |
Are you charged with criminal offense?Contact us today to ensure your rights and freedom are preserved at an affordable price. |
| H1 |
Criminal Defense |
| H2 |
Call Toll Free |
| H3 |
Former District Attorney and Prosecutor for 20 years in Nevada now helps with Criminal Defense cases at Half Price Lawyers. |
Similar domain names
halfpriceleather.comhalfpriceleathergoods.comhalfpriceledwarehouse.comhalfpricelasvegasraiderstickets.comhalfpricelashes.comhalfpricekush.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Stop charging my account or police and better business bureau will be notified
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...