7 This page 7 shows every 2017/03/01 domain - Net Home

All domains reserved during 2017/03/01

# Domain Found TLD
0 asaanrasta.com 9 months ago com
1 asahichineserestaurant.com 9 months ago com
2 themagentahornet.com 9 months ago com
3 ascensoreseelevadores.com 9 months ago com
4 themegaminds.com 9 months ago com
5 asenappar-hotel.com 9 months ago com
6 asetpemprovsumbar.com 9 months ago com
7 asheemaletube.com 9 months ago com
8 ashemaletunbe.com 9 months ago com
9 themunchandtattle.com 9 months ago com
10 asianshemaleonline.com 9 months ago com
11 thenihalansari.com 9 months ago com
12 asianmilfwebcam.com 9 months ago com
13 asiashowtime.com 9 months ago com
14 asicsvietnam.com 9 months ago com
15 askkilari.com 9 months ago com
16 asleepbook.com 9 months ago com
17 aspakhu.com 9 months ago com
18 thepacked.com 9 months ago com
19 asrshop.com 9 months ago com
20 ass-butts.com 9 months ago com
21 assalamcianjur.com 9 months ago com
22 assembliesofgodayambo.com 9 months ago com
23 assetsgap.com 9 months ago com
24 asshero.com 9 months ago com
25 assiferj.com 9 months ago com
26 assistirfilmesonline-hd.com 9 months ago com
27 asterhung.com 9 months ago com
28 theplatcal.com 9 months ago com
29 thepocketblunt.com 9 months ago com
30 astrakozmetik.com 9 months ago com
31 astrologia-horae.com 9 months ago com
32 atackozmetik.com 9 months ago com
33 atarmotor.com 9 months ago com
34 atbehede.com 9 months ago com
35 atefeid.com 9 months ago com
36 athaiabich.com 9 months ago com
37 athena-sample.com 9 months ago com
38 aticimehmet.com 9 months ago com
39 thesaabgarage.com 9 months ago com
40 atlanticprintinganddesign.com 9 months ago com
41 atlantikmedikal.com 9 months ago com
42 theseaures.com 9 months ago com
43 atmosua.com 9 months ago com
44 atnenna.com 9 months ago com
45 atopi6.com 9 months ago com
46 atozrafeek.com 9 months ago com
47 atseoul.com 9 months ago com
48 attorneyadrianmi.com 9 months ago com
49 atv-orenburg.com 9 months ago com
50 atzee7.com 9 months ago com
51 thetilemasterga.com 9 months ago com
52 thetpaingthu.com 9 months ago com
53 thetrashycircusranch.com 9 months ago com
54 auditor-internal.com 9 months ago com
55 augustgeo.com 9 months ago com
56 aumacibadem.com 9 months ago com
57 auntatmachinery.com 9 months ago com
58 aurorised.com 9 months ago com
59 thevintagemarketplaceatgalwaydowns.com 9 months ago com
60 thewiscoshow.com 9 months ago com
61 thi8ah.com 9 months ago com
62 thicongxonghoispa.com 9 months ago com
63 autodespachocanarias.com 9 months ago com
64 autoinsurancecarinsurance.com 9 months ago com
65 autokoreagt.com 9 months ago com
66 automag72.com 9 months ago com
67 autoposteador.com 9 months ago com
68 autopostfacebook.com 9 months ago com
69 thisishel.com 9 months ago com
70 thnzaukloew.com 9 months ago com
71 avantage-salon.com 9 months ago com
72 avd-adv-2.com 9 months ago com
73 avelere.com 9 months ago com
74 avelontechnologies.com 9 months ago com
75 avidevelopment-m.com 9 months ago com
76 avoltonline.com 9 months ago com
77 thuocchuahiemmuongiatruyenlegia.com 9 months ago com
78 avrora-ko.com 9 months ago com
79 avto-room.com 9 months ago com
80 tidwaterandtulle.com 9 months ago com
81 axdck.com 9 months ago com
82 ayamdanbabi.com 9 months ago com
83 tigersthirdeye.com 9 months ago com
84 ayakkabisecimi.com 9 months ago com
85 aysarumroh.com 9 months ago com
86 ayunhabebatak.com 9 months ago com
87 ayuniehijab.com 9 months ago com
88 azanisserum.com 9 months ago com
89 azddm.com 9 months ago com
90 azbizpros.com 9 months ago com
91 azoninvestigator.com 9 months ago com
92 titanium-jewlery.com 9 months ago com
93 b-edelta.com 9 months ago com
94 azwirnazar.com 9 months ago com
95 b-onstage.com 9 months ago com
96 b-realtor.com 9 months ago com
97 ba2news.com 9 months ago com
98 babakrp.com 9 months ago com
99 babecupid.com 9 months ago com

Pages: 1 / 2 / 3 / 4 / 5 / 6 / 7 / 8 / 9 / 10 / 11 / ... 28