7 This page 7 shows every 2017/03/01 domain - Net Home

All domains reserved during 2017/03/01

# Domain Found TLD
0 asaanrasta.com 1 year ago com
1 asahichineserestaurant.com 1 year ago com
2 themagentahornet.com 1 year ago com
3 ascensoreseelevadores.com 1 year ago com
4 themegaminds.com 1 year ago com
5 asenappar-hotel.com 1 year ago com
6 asetpemprovsumbar.com 1 year ago com
7 asheemaletube.com 1 year ago com
8 ashemaletunbe.com 1 year ago com
9 themunchandtattle.com 1 year ago com
10 asianshemaleonline.com 1 year ago com
11 thenihalansari.com 1 year ago com
12 asianmilfwebcam.com 1 year ago com
13 asiashowtime.com 1 year ago com
14 asicsvietnam.com 1 year ago com
15 askkilari.com 1 year ago com
16 asleepbook.com 1 year ago com
17 aspakhu.com 1 year ago com
18 thepacked.com 1 year ago com
19 asrshop.com 1 year ago com
20 ass-butts.com 1 year ago com
21 assalamcianjur.com 1 year ago com
22 assembliesofgodayambo.com 1 year ago com
23 assetsgap.com 1 year ago com
24 asshero.com 1 year ago com
25 assiferj.com 1 year ago com
26 assistirfilmesonline-hd.com 1 year ago com
27 asterhung.com 1 year ago com
28 theplatcal.com 1 year ago com
29 thepocketblunt.com 1 year ago com
30 astrakozmetik.com 1 year ago com
31 astrologia-horae.com 1 year ago com
32 atackozmetik.com 1 year ago com
33 atarmotor.com 1 year ago com
34 atbehede.com 1 year ago com
35 atefeid.com 1 year ago com
36 athaiabich.com 1 year ago com
37 athena-sample.com 1 year ago com
38 aticimehmet.com 1 year ago com
39 thesaabgarage.com 1 year ago com
40 atlanticprintinganddesign.com 1 year ago com
41 atlantikmedikal.com 1 year ago com
42 theseaures.com 1 year ago com
43 atmosua.com 1 year ago com
44 atnenna.com 1 year ago com
45 atopi6.com 1 year ago com
46 atozrafeek.com 1 year ago com
47 atseoul.com 1 year ago com
48 attorneyadrianmi.com 1 year ago com
49 atv-orenburg.com 1 year ago com
50 atzee7.com 1 year ago com
51 thetilemasterga.com 1 year ago com
52 thetpaingthu.com 1 year ago com
53 thetrashycircusranch.com 1 year ago com
54 auditor-internal.com 1 year ago com
55 augustgeo.com 1 year ago com
56 aumacibadem.com 1 year ago com
57 auntatmachinery.com 1 year ago com
58 aurorised.com 1 year ago com
59 thevintagemarketplaceatgalwaydowns.com 1 year ago com
60 thewiscoshow.com 1 year ago com
61 thi8ah.com 1 year ago com
62 thicongxonghoispa.com 1 year ago com
63 autodespachocanarias.com 1 year ago com
64 autoinsurancecarinsurance.com 1 year ago com
65 autokoreagt.com 1 year ago com
66 automag72.com 1 year ago com
67 autoposteador.com 1 year ago com
68 autopostfacebook.com 1 year ago com
69 thisishel.com 1 year ago com
70 thnzaukloew.com 1 year ago com
71 avantage-salon.com 1 year ago com
72 avd-adv-2.com 1 year ago com
73 avelere.com 1 year ago com
74 avelontechnologies.com 1 year ago com
75 avidevelopment-m.com 1 year ago com
76 avoltonline.com 1 year ago com
77 thuocchuahiemmuongiatruyenlegia.com 1 year ago com
78 avrora-ko.com 1 year ago com
79 avto-room.com 1 year ago com
80 tidwaterandtulle.com 1 year ago com
81 axdck.com 1 year ago com
82 ayamdanbabi.com 1 year ago com
83 tigersthirdeye.com 1 year ago com
84 ayakkabisecimi.com 1 year ago com
85 aysarumroh.com 1 year ago com
86 ayunhabebatak.com 1 year ago com
87 ayuniehijab.com 1 year ago com
88 azanisserum.com 1 year ago com
89 azddm.com 1 year ago com
90 azbizpros.com 1 year ago com
91 azoninvestigator.com 1 year ago com
92 titanium-jewlery.com 1 year ago com
93 b-edelta.com 1 year ago com
94 azwirnazar.com 1 year ago com
95 b-onstage.com 1 year ago com
96 b-realtor.com 1 year ago com
97 ba2news.com 1 year ago com
98 babakrp.com 1 year ago com
99 babecupid.com 1 year ago com

Pages: 1 / 2 / 3 / 4 / 5 / 6 / 7 / 8 / 9 / 10 / 11 / ... 28

DMCA.com Protection Status